General Information

  • ID:  hor004592
  • Uniprot ID:  P21753
  • Protein name:  Thymosin beta-10
  • Gene name:  TMSB10
  • Organism:  Sus scrofa (Pig)
  • Family:  Thymosin beta family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003779 actin binding; GO:0003785 actin monomer binding
  • GO BP:  GO:0007015 actin filament organization; GO:0030334 regulation of cell migration; GO:0042989 sequestering of actin monomers
  • GO CC:  GO:0005737 cytoplasm; GO:0005856 cytoskeleton

Sequence Information

  • Sequence:  ADKPDMGEINSFDKAKLKKTETQEKNTLPTKETIEQEKQAK
  • Length:  41(2-42)
  • Propeptide:  MADKPDMGEINSFDKAKLKKTETQEKNTLPTKETIEQEKQAK
  • Signal peptide:  NA
  • Modification:  T1 N-acetylalanine;T3 N6-acetyllysine;T11 Phosphoserine;T14 N6-acetyllysine;T20 Phosphothreonine;T22 Phosphothreonine;T33 Phosphothreonine;T38 N6-acetyllysine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays an important role in the organization of the cytoskeleton.
  • Mechanism:  Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P21753-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004592_AF2.pdbhor004592_ESM.pdb

Physical Information

Mass: 540593 Formula: C201H337N55O71S
Absent amino acids: CHRVWY Common amino acids: K
pI: 6.8 Basic residues: 9
Polar residues: 9 Hydrophobic residues: 8
Hydrophobicity: -159.27 Boman Index: -13174
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 45.37
Instability Index: 3744.39 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  2774558
  • Title:  Isolation and characterization of thymosin beta 9 Met from pork spleen.
  • PubMed ID:  2090639
  • Title:  Structure and immunological properties of thymosin beta 9 Met, a new analog of thymosin beta 4 isolated from porcine thymus.